Structure of PDB 4e5j Chain A

Receptor sequence

>4e5jA (length=181) Species: 284218 (Influenza A virus (A/Viet Nam/1203/2004(H5N1)))

MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD
GGSKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIE
IGVTRREVHTYYLEKANKIKSEETHIHIFSFTGEEMATKADYTLDEESRA
RIKTRLFTIRQEMASRGLWDSFRQSERAAAE

3D structure

• PDB: 4e5j Structural and Biochemical Basis for Development of Influenza Virus Inhibitors Targeting the PA Endonuclease.
• Chain: A
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	581	A	H41 E80 D108 E119 Y130 K134	H41 E61 D89 E100 Y111 K115	MOAD: Ki=18.7uM PDBbind-CN: -logKd/Ki=4.73,Ki=18.7uM
BS02	581	A	K34 A37 I38 H41 V122 R124 A198	K34 A37 I38 H41 V103 R105 A179	MOAD: Ki=18.7uM PDBbind-CN: -logKd/Ki=4.73,Ki=18.7uM
BS03	MN	A	H41 D108 E119 I120	H41 D89 E100 I101
BS04	MN	A	E80 D108	E61 D89

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:4e5j, PDBe:4e5j, PDBj:4e5j
• PDBsum: 4e5j
• PubMed: 22876176
• UniProt: Q5EP34