Structure of PDB 4e5g Chain A

Receptor sequence

>4e5gA (length=181) Species: 284218 (Influenza A virus (A/Viet Nam/1203/2004(H5N1)))

MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD
GGSKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIE
IGVTRREVHTYYLEKANKIKSEETHIHIFSFTGEEMATKADYTLDEESRA
RIKTRLFTIRQEMASRGLWDSFRQSERAAAE

3D structure

• PDB: 4e5g Structural and Biochemical Basis for Development of Influenza Virus Inhibitors Targeting the PA Endonuclease.
• Chain: A
• Resolution: 2.647 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	E80 P107 D108	E61 P88 D89
BS02	MN	A	H41 D108 E119 I120	H41 D89 E100 I101
BS03	XI7	A	H41 E80 E119 K134	H41 E61 E100 K115	PDBbind-CN: -logKd/Ki=4.67,IC50=21.3uM
BS04	XI7	A	A20 Y24 I38 H41	A20 Y24 I38 H41	PDBbind-CN: -logKd/Ki=4.67,IC50=21.3uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:4e5g, PDBe:4e5g, PDBj:4e5g
• PDBsum: 4e5g
• PubMed: 22876176
• UniProt: Q5EP34