Structure of PDB 4dz6 Chain A

Receptor sequence
>4dz6A (length=168) Species: 139 (Borreliella burgdorferi) [Search protein sequence]
SMLLQKTLCIVKPDGVRRGLIGDVVSRFERVGLKMVAAKMLIVDESLAKK
HYLYDDIVFRHSEAVWNSLIKFISNSPVFTFVVEGVESIEVVRKLCGATE
PKLAIPGTIRGDFSYHSFKYSNEKGFSIYNVIHASANEADAMREIPIWFK
DNEILNYKRDDECEHYYC
3D structure
PDB4dz6 Structure and analysis of nucleoside diphosphate kinase from Borrelia burgdorferi prepared in a transition-state complex with ADP and vanadate moieties.
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 Y53 N131 H134 E145
Catalytic site (residue number reindexed from 1) K12 Y52 N130 H133 E144
Enzyme Commision number 2.7.4.6: nucleoside-diphosphate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A K13 R61 H62 V66 L70 R94 T100 F119 S122 I129 N131 K12 R60 H61 V65 L69 R93 T99 F118 S121 I128 N130
BS02 VN4 A K13 Y53 H134 A135 K12 Y52 H133 A134
Gene Ontology
Molecular Function
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0006183 GTP biosynthetic process
GO:0006228 UTP biosynthetic process
GO:0006241 CTP biosynthetic process
GO:0009117 nucleotide metabolic process
GO:0016310 phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dz6, PDBe:4dz6, PDBj:4dz6
PDBsum4dz6
PubMed29870023
UniProtO51419|NDK_BORBU Nucleoside diphosphate kinase (Gene Name=ndk)

[Back to BioLiP]