Structure of PDB 4dxa Chain A

Receptor sequence

>4dxaA (length=168) Species: 9606 (Homo sapiens) [Search protein sequence]

SMREYKLVVLGSVGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQ
QCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQ
ILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAK
SKINVNEIFYDLVRQINR

3D structure

PDB

4dxa Structural Basis for Small G Protein Effector Interaction of Ras-related Protein 1 (Rap1) and Adaptor Protein Krev Interaction Trapped 1 (KRIT1).

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSP	A	V12 G13 V14 G15 K16 S17 A18 F28 E30 Y32 T35 G60 N116 K117 D119 L120 S147 K149	V13 G14 V15 G16 K17 S18 A19 F29 E31 Y33 T36 G61 N117 K118 D120 L121 S148 K150
BS02	MG	A	S17 T35	S18 T36

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0044877	protein-containing complex binding

	Biological Process
GO:0007165	signal transduction
GO:0007264	small GTPase-mediated signal transduction
GO:0008283	cell population proliferation
GO:0017156	calcium-ion regulated exocytosis
GO:0030033	microvillus assembly
GO:0032486	Rap protein signal transduction
GO:0033625	positive regulation of integrin activation
GO:0045955	negative regulation of calcium ion-dependent exocytosis
GO:0051649	establishment of localization in cell
GO:0061028	establishment of endothelial barrier
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0071320	cellular response to cAMP
GO:0099010	modification of postsynaptic structure
GO:1901888	regulation of cell junction assembly
GO:2000114	regulation of establishment of cell polarity
GO:2000301	negative regulation of synaptic vesicle exocytosis

	Cellular Component
GO:0005737	cytoplasm
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005911	cell-cell junction
GO:0016020	membrane
GO:0035577	azurophil granule membrane
GO:0045121	membrane raft
GO:0070062	extracellular exosome
GO:0070161	anchoring junction
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4dxa, PDBe:4dxa, PDBj:4dxa
PDBsum	4dxa
PubMed	22577140
UniProt	P61224\|RAP1B_HUMAN Ras-related protein Rap-1b (Gene Name=RAP1B)

[Back to BioLiP]