Structure of PDB 4dst Chain A

Receptor sequence
>4dstA (length=180) Species: 9606 (Homo sapiens) [Search protein sequence]
STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQI
KRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQ
GVDDAFYTLVREIRKHKEKMSKDGKKKKKK
3D structure
PDB4dst Small-molecule ligands bind to a distinct pocket in Ras and inhibit SOS-mediated nucleotide exchange activity.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 9LI A S39 D54 I55 L56 T74 G75 S39 D54 I55 L56 T74 G75 PDBbind-CN: -logKd/Ki=2.96,Kd=1.1mM
BindingDB: IC50=155000nM
BS02 MG A S17 T35 S17 T35
BS03 MG A G10 A59 G60 Y96 G10 A59 G60 Y96
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0043495 protein-membrane adaptor activity
GO:0044877 protein-containing complex binding
Biological Process
GO:0000165 MAPK cascade
GO:0001934 positive regulation of protein phosphorylation
GO:0007165 signal transduction
GO:0007265 Ras protein signal transduction
GO:0008283 cell population proliferation
GO:0008542 visual learning
GO:0010467 gene expression
GO:0010628 positive regulation of gene expression
GO:0014009 glial cell proliferation
GO:0016601 Rac protein signal transduction
GO:0021897 forebrain astrocyte development
GO:0030036 actin cytoskeleton organization
GO:0030857 negative regulation of epithelial cell differentiation
GO:0032228 regulation of synaptic transmission, GABAergic
GO:0035022 positive regulation of Rac protein signal transduction
GO:0035914 skeletal muscle cell differentiation
GO:0043524 negative regulation of neuron apoptotic process
GO:0048169 regulation of long-term neuronal synaptic plasticity
GO:0048873 homeostasis of number of cells within a tissue
GO:0051146 striated muscle cell differentiation
GO:0051402 neuron apoptotic process
GO:0060252 positive regulation of glial cell proliferation
GO:0060441 epithelial tube branching involved in lung morphogenesis
GO:0060509 type I pneumocyte differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005741 mitochondrial outer membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0009898 cytoplasmic side of plasma membrane
GO:0012505 endomembrane system
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dst, PDBe:4dst, PDBj:4dst
PDBsum4dst
PubMed22431598
UniProtP01116|RASK_HUMAN GTPase KRas (Gene Name=KRAS)

[Back to BioLiP]