Structure of PDB 4ds1 Chain A

Receptor sequence

>4ds1A (length=86) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

STPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNT
WHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA

3D structure

PDB

4ds1 Structure of a yeast Dyn2-Nup159 complex and molecular basis for dynein light chain-nuclear pore interaction.

Chain

Resolution

1.851 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K12 K63 N64 F65 G66 S67 Y68 V69 T70 H71 F76 Y78 Y80 A92	K6 K57 N58 F59 G60 S61 Y62 V63 T64 H65 F70 Y72 Y74 A86
BS02	peptide	A	E38 R39	E32 R33

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008574	plus-end-directed microtubule motor activity
GO:0045505	dynein intermediate chain binding

	Biological Process
GO:0000132	establishment of mitotic spindle orientation
GO:0006913	nucleocytoplasmic transport
GO:0007017	microtubule-based process
GO:0015031	protein transport
GO:0030473	nuclear migration along microtubule
GO:0040001	establishment of mitotic spindle localization
GO:0051028	mRNA transport
GO:0051292	nuclear pore complex assembly

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005643	nuclear pore
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005868	cytoplasmic dynein complex
GO:0005874	microtubule
GO:0005875	microtubule associated complex
GO:0005881	cytoplasmic microtubule
GO:0015630	microtubule cytoskeleton
GO:0030286	dynein complex
GO:0034399	nuclear periphery
GO:1990429	peroxisomal importomer complex

External links

PDB	RCSB:4ds1, PDBe:4ds1, PDBj:4ds1
PDBsum	4ds1
PubMed	22411995
UniProt	Q02647\|DYL1_YEAST Dynein light chain 1, cytoplasmic (Gene Name=DYN2)