Structure of PDB 4dmn Chain A |
>4dmnA (length=145) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] |
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKL AGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQ VRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ |
|
PDB | 4dmn Multimode, cooperative mechanism of action of allosteric HIV-1 integrase inhibitors. |
Chain | A |
Resolution | 2.45 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
0L9 |
A |
T124 A128 W132 |
T70 A74 W78 |
MOAD: ic50=2.3uM PDBbind-CN: -logKd/Ki=5.64,IC50=2.3uM BindingDB: IC50=4e+2nM |
|
|
|