Structure of PDB 4djf Chain A

Receptor sequence

>4djfA (length=262) Species: 1525 (Moorella thermoacetica)

MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAV
QDKVSAMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNA
EREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEF
GLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSNV
SQNCQNRPLINRTFLAMAMACGLDAAIADACDEALIETAATAEILLNQTV
YCDSFVKMFKTR

3D structure

• PDB: 4djf Visualizing molecular juggling within a B12-dependent methyltransferase complex.
• Chain: A
• Resolution: 3.03 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.258: 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	C2F	A	E6 M11 F12 D75 N96 D160 S198 N199 R207	E6 M11 F12 D75 N96 D160 S198 N199 R207
BS02	CA	A	G222 D224	G222 D224
BS03	COB	A	V168 Q202 N203	V168 Q202 N203

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008705 methionine synthase activity
• GO:0031419 cobalamin binding
• GO:0046872 metal ion binding
• GO:0102036 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase activity

Biological Process

• GO:0009086 methionine biosynthetic process
• GO:0015977 carbon fixation
• GO:0032259 methylation
• GO:0042558 pteridine-containing compound metabolic process
• GO:0044237 cellular metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4djf, PDBe:4djf, PDBj:4djf
• PDBsum: 4djf
• PubMed: 22419154
• UniProt: Q46389|ACSE_MOOTH 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase (Gene Name=acsE)