Structure of PDB 4dgb Chain A

Receptor sequence

>4dgbA (length=163) Species: 9544 (Macaca mulatta) [Search protein sequence]

VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGS
CFHRIIPGFMCQGGNFTHHNGTGGKSIYGEKFEDENFILKHTGPGILSMA
NAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGK
TSKKITIADCGQL

3D structure

PDB

4dgb Diverse HIV viruses are targeted by a conformationally dynamic antiviral.

Chain

Resolution

1.702 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	R55 F60 Q63 N102 F113 L122 H126
Catalytic site (residue number reindexed from 1)	R54 F59 Q62 N101 F112 L121 H125
Enzyme Commision number	5.2.1.8: peptidylprolyl isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	R55 F60 Q63 F113 W121 L122	R54 F59 Q62 F112 W120 L121

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0005178	integrin binding
GO:0016018	cyclosporin A binding
GO:1904399	heparan sulfate binding

	Biological Process
GO:0000413	protein peptidyl-prolyl isomerization
GO:0001933	negative regulation of protein phosphorylation
GO:0001934	positive regulation of protein phosphorylation
GO:0006457	protein folding
GO:0006469	negative regulation of protein kinase activity
GO:0006915	apoptotic process
GO:0030168	platelet activation
GO:0030593	neutrophil chemotaxis
GO:0030595	leukocyte chemotaxis
GO:0032148	activation of protein kinase B activity
GO:0032873	negative regulation of stress-activated MAPK cascade
GO:0034599	cellular response to oxidative stress
GO:0042118	endothelial cell activation
GO:0043410	positive regulation of MAPK cascade
GO:0045069	regulation of viral genome replication
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0060352	cell adhesion molecule production
GO:0061944	negative regulation of protein K48-linked ubiquitination
GO:0070527	platelet aggregation
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:2001233	regulation of apoptotic signaling pathway

	Cellular Component
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4dgb, PDBe:4dgb, PDBj:4dgb
PDBsum	4dgb
PubMed	22407016
UniProt	P62940\|PPIA_MACMU Peptidyl-prolyl cis-trans isomerase A (Gene Name=PPIA)

[Back to BioLiP]