Structure of PDB 4der Chain A

Receptor sequence

>4derA (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTNP

3D structure

• PDB: 4der Flavonoid interactions with human transthyretin: Combined structural and thermodynamic analysis.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AGI	A	K15 A108 L110	K6 A99 L101	MOAD: Kd=0.49uM PDBbind-CN: -logKd/Ki=6.31,Kd=0.49uM BindingDB: IC50=653nM,Kd=250nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4der, PDBe:4der, PDBj:4der
• PDBsum: 4der
• PubMed: 22842046
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)