Structure of PDB 4dcp Chain A |
>4dcpA (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] |
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTEFDCGIET |
|
PDB | 4dcp Molecular insight into the role of the leucine residue on the L2 loop in the catalytic activity of caspases 3 and 7 |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R64 H121 C163 |
R31 H88 C130 |
|
|
|
|