Structure of PDB 4dch Chain A

Receptor sequence
>4dchA (length=434) Species: 9606 (Homo sapiens) [Search protein sequence]
EAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKML
PTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGGQWSVKTKHQMYSI
PEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPNNVVGLL
RDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYM
EEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPG
QQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFV
SQVESDTGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAG
LAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKERFHASVRRLTPSCE
ITFIESEEGSGRGAALVSAVACKKACMLGQLEHH
3D structure
PDB4dch Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
ChainA
Resolution1.79 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R85 S151 D205
Catalytic site (residue number reindexed from 1) R77 S141 D170
Enzyme Commision number 2.7.1.1: hexokinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A N204 D205 I225 G229 N231 E256 E290 N169 D170 I190 G194 N196 E221 E255
BS02 4DC A R63 T65 P66 E67 Q98 W99 Y214 K458 K459 R55 T57 P58 E59 Q88 W89 Y179 K423 K424 BindingDB: Kd=500nM,EC50=500nM
Gene Ontology
Molecular Function
GO:0004340 glucokinase activity
GO:0004396 hexokinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005536 D-glucose binding
GO:0008865 fructokinase activity
GO:0016301 kinase activity
GO:0016773 phosphotransferase activity, alcohol group as acceptor
GO:0019158 mannokinase activity
GO:0141089 glucose sensor activity
Biological Process
GO:0001678 intracellular glucose homeostasis
GO:0005975 carbohydrate metabolic process
GO:0006006 glucose metabolic process
GO:0006007 glucose catabolic process
GO:0006096 glycolytic process
GO:0006110 regulation of glycolytic process
GO:0006739 NADP metabolic process
GO:0009749 response to glucose
GO:0016310 phosphorylation
GO:0019318 hexose metabolic process
GO:0032024 positive regulation of insulin secretion
GO:0032869 cellular response to insulin stimulus
GO:0042593 glucose homeostasis
GO:0043266 regulation of potassium ion transport
GO:0044320 cellular response to leptin stimulus
GO:0045721 negative regulation of gluconeogenesis
GO:0045725 positive regulation of glycogen biosynthetic process
GO:0046835 carbohydrate phosphorylation
GO:0050796 regulation of insulin secretion
GO:0051156 glucose 6-phosphate metabolic process
GO:0061621 canonical glycolysis
GO:0070509 calcium ion import
GO:1901135 carbohydrate derivative metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dch, PDBe:4dch, PDBj:4dch
PDBsum4dch
PubMed22298776
UniProtP35557|HXK4_HUMAN Hexokinase-4 (Gene Name=GCK)

[Back to BioLiP]