Structure of PDB 4dc2 Chain A

Receptor sequence

>4dc2A (length=329) Species: 10090 (Mus musculus)

LGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMRVVKKELVNIDWVQTE
KHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPE
EHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKE
GLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSP
FDIVGSNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCH
PQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTN
EPVQLTPDDDDIVRKIDQSEFEGFEYINP

3D structure

• PDB: 4dc2 Substrate recognition mechanism of atypical protein kinase Cs revealed by the structure of PKC iota in complex with a substrate peptide from Par-3
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D368 K370 N373 D386 T406
• Catalytic site (residue number reindexed from 1): D126 K128 N131 D144 T164
• Enzyme Commision number: 2.7.11.13: protein kinase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D329 M331 M334 Q335 R338 D368 D372 M389 C404 G405 T406 P407 N408 E435 G439 R440 I445 V446 G447 T456 D543 F546	D87 M89 M92 Q93 R96 D126 D130 M147 C162 G163 T164 P165 N166 E193 G197 R198 I203 V204 G205 T208 D295 F298
BS02	ADE	A	A271 I322 V325 L375 T385 F542	A33 I80 V83 L133 T143 F294

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0004697 diacylglycerol-dependent serine/threonine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:4dc2, PDBe:4dc2, PDBj:4dc2
• PDBsum: 4dc2
• PubMed: 22579248
• UniProt: Q62074|KPCI_MOUSE Protein kinase C iota type (Gene Name=Prkci)