Structure of PDB 4d4x Chain A

Receptor sequence
>4d4xA (length=126) Species: 85698 (Achromobacter xylosoxidans) [Search protein sequence]
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKT
LSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAG
DLDKLRAAFGDVGASCKACHIAYRKK
3D structure
PDB4d4x Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
ChainA
Resolution1.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A R12 Q13 L16 M19 A20 W56 F59 D67 F79 Q83 F86 C116 C119 R124 R12 Q13 L16 M19 A20 W56 F59 D67 F79 Q83 F86 C116 C119 R124
BS02 NO A H120 R124 H120 R124
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0022900 electron transport chain
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d4x, PDBe:4d4x, PDBj:4d4x
PDBsum4d4x
PubMed26100643
UniProtP00138|CYCP_ALCXX Cytochrome c'

[Back to BioLiP]