Structure of PDB 4d4i Chain A

Receptor sequence

>4d4iA (length=481) Species: 1160 (Planktothrix agardhii)

FKQSIHQLFETQVERTPEAVAVLSEQGQLTYEELNTKANQLAHYLRTLGV
KSETLVGVCVDRSLEMVIGLLAILKAGGAYVPLDPTYPRERLTYMVQDAQ
ISVLVTQTQWSNLISDYQGQVICLDSQWAKIASYSQENLVNTVNPENLAY
VIYTSGSTGKPKGVMIEHQSLVNFTKLAIAQYQITTSDRTLQFVSISFDV
AAEEIYVTLCSGATLILRTEEMISSIPSFVQKSQDWQITVWSLPTAYWHL
LVNELVKSKIALPDSLRLVIIGGERVQPELVRMWFKNVGNFPELINVYGP
TEGTIAVSLCRLSQLTESQRNRTEIPIGKSLGENISVYVLDETLKTVPPE
TPGEIYIGGTALARGYLNRPELTAQKFIQDPFSPSERLYKTGDLGRYLAD
GNLEYLGRVDHQVKINGFRVELGEIETVLLQHHQVAQAVVIDRRLVAYLV
PHSTEENLTVTLQQFLKNKLPSYMIPATFVV

3D structure

• PDB: 4d4i Structural Elucidation of the Bispecificity of a Domains as a Basis for Activating Non-Natural Amino Acids.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T155 F175 T302 E303 K415 R420
• Catalytic site (residue number reindexed from 1): T154 F174 T301 E302 K414 R419

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ARG	A	V201 E204 I271 G273 G274 V298 Y299 G300 I306	V200 E203 I270 G272 G273 V297 Y298 G299 I305
BS02	ANP	A	T155 F199 G274 E275 R276 N297 V298 Y299 G300 P301 T302 I328 D394 Y406 K415 R420	T154 F198 G273 E274 R275 N296 V297 Y298 G299 P300 T301 I327 D393 Y405 K414 R419
BS03	MG	A	D200 T302 I306	D199 T301 I305

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0031177 phosphopantetheine binding
• GO:0046872 metal ion binding

Biological Process

• GO:0043041 amino acid activation for nonribosomal peptide biosynthetic process
• GO:0044550 secondary metabolite biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4d4i, PDBe:4d4i, PDBj:4d4i
• PDBsum: 4d4i
• PubMed: 26096082
• UniProt: G0WVH3