Structure of PDB 4cyc Chain A

Receptor sequence
>4cycA (length=66) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
FYPWMARQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIW
FQNRRMKLKKEIQAIK
3D structure
PDB4cyc A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
ChainA
Resolution2.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R5 T7 Q50 R53 M54 K57 R7 T9 Q52 R55 M56 K59
BS02 dna A R5 Q6 T7 Y8 Q44 I47 N51 K55 R7 Q8 T9 Y10 Q46 I49 N53 K57
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cyc, PDBe:4cyc, PDBj:4cyc
PDBsum4cyc
PubMed25651060
UniProtP83949|UBX_DROME Homeotic protein ultrabithorax (Gene Name=Ubx)

[Back to BioLiP]