Structure of PDB 4cv3 Chain A

Receptor sequence
>4cv3A (length=239) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence]
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEF
AAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLD
GDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAER
AIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPICEAVTPIRR
TVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
3D structure
PDB4cv3 Rational Design of Broad Spectrum Antibacterial Activity Based on a Clinically Relevant Enoyl-Acyl Carrier Protein (Acp) Reductase Inhibitor.
ChainA
Resolution1.95 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 VT4 A G93 Y146 Y156 G92 Y145 Y155 MOAD: Ki=7nM
BS02 NAI A G13 A15 S19 I20 Q40 D64 V65 S91 I92 S145 Y146 K163 A189 P191 I192 G12 A14 S18 I19 Q39 D63 V64 S90 I91 S144 Y145 K162 A188 P190 I191
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 06:39:52 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4cv3', asym_id = 'A', title = 'Rational Design of Broad Spectrum Antibacterial ...-Acyl Carrier Protein (Acp) Reductase Inhibitor. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4cv3', asym_id='A', title='Rational Design of Broad Spectrum Antibacterial ...-Acyl Carrier Protein (Acp) Reductase Inhibitor. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '4cv3', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='4cv3', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>