Structure of PDB 4cuo Chain A

Receptor sequence

>4cuoA (length=306) Species: 309271 (Ficus benghalensis)

QLTPTFYRSTCPNVTSIVRGVIQDALQTDLRIPASLIRLHFHDCFVNGCD
GSLLLDNSDTIESEKQAAPNNNSARGFDVVDNIKTAVENACPGVVSCADI
LTIAAEQSVWLSGGPSWPVPLGRRDSLTANRTLANQTLPSPFLTLDQLKT
DFSDQGLNTTDLVALSGAHTFGRAQCQFFSQRLYNFSATGSPDPTLNTTL
LETLRNICPQGGNGSTITNLDQTTPDAFDNKYFSNLQTQYGILQTDQELF
STKGANTTAIVTKFSANQSAFFNSFVASMIKMGNIGVLTNDEGEIRSNCR
SVNGGA

3D structure

• PDB: 4cuo Post-Translational Modification and Extended Glycosylation Pattern of a Plant Latex Peroxidase of Native Source Characterized by X-Ray Crystallography.
• Chain: A
• Resolution: 1.67 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R38 H42 N70 H169
• Catalytic site (residue number reindexed from 1): R38 H42 N70 H169
• Enzyme Commision number: 1.11.1.7: peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	R31 A34 S35 R38 F41 S73 P139 S140 P141 F152 A168 H169 G172 R173 A174 Q175 F178 L220 L243	R31 A34 S35 R38 F41 S73 P139 S140 P141 F152 A168 H169 G172 R173 A174 Q175 F178 L220 L243
BS02	CA	A	T170 D221 T224 A227 D229	T170 D221 T224 A227 D229
BS03	CA	A	D43 V46 G48 D50 S52	D43 V46 G48 D50 S52
BS04	CO3	A	T15 R19 Q107	T15 R19 Q107
BS05	CO3	A	T224 P225 D226 A227	T224 P225 D226 A227

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0140825 lactoperoxidase activity

Biological Process

• GO:0006979 response to oxidative stress
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4cuo, PDBe:4cuo, PDBj:4cuo
• PDBsum: 4cuo
• PubMed: 24980207
• UniProt: A0A087WNH2