Structure of PDB 4co4 Chain A

Receptor sequence
>4co4A (length=90) Species: 192 (Azospirillum brasilense) [Search protein sequence]
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFFLPKVKVEVAVSDD
QYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETN
3D structure
PDB4co4 Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP A I7 G35 F36 K58 I86 G87 G89 K90 I7 G35 F36 K40 I68 G69 G71 K72 MOAD: Kd=2uM
BS02 PO4 A S31 K60 S31 K42
BS03 PO4 A K60 E62 K42 E44
BS04 ATP A G27 T29 V63 A64 R101 R103 G27 T29 V45 A46 R83 R85 MOAD: Kd=2uM
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
GO:0046872 metal ion binding
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4co4, PDBe:4co4, PDBj:4co4
PDBsum4co4
PubMed24846646
UniProtP70731

[Back to BioLiP]