Structure of PDB 4cn7 Chain A

Receptor sequence
>4cn7A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence]
GSHMFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREA
3D structure
PDB4cn7 Structural Basis of Natural Promoter Recognition by the Retinoid X Nuclear Receptor.
ChainA
Resolution2.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K145 H146 Y147 K156 K160 R202 K20 H21 Y22 K31 K35 R77 PDBbind-CN: Kd=155nM
BS02 dna A E153 G154 R161 R184 N185 R191 E28 G29 R36 R59 N60 R66 PDBbind-CN: Kd=155nM
BS03 ZN A C135 C138 C155 C10 C13 C30
BS04 ZN A C171 C177 C187 C190 C46 C52 C62 C65
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4cn7, PDBe:4cn7, PDBj:4cn7
PDBsum4cn7
PubMed25645674
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]