Structure of PDB 4cl0 Chain A

Receptor sequence

>4cl0A (length=140) Species: 1773 (Mycobacterium tuberculosis)

LIVNVINGPNLGRLGRREPAVYGGTTHDELVALIEREAAELGLKAVVRQS
DSEAQLLDWIHQAADAAEPVILNAGGLTHTSVALRDACAELSAPLIEVHI
SNVHAREEFRRHSYLSPIATGVIVGLGIQGYLLALRYLAE

3D structure

• PDB: 4cl0 Investigation of the Dehydratation Mechanism Catalyzed by the Type II Dehydroquinase
• Chain: A
• Resolution: 3.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P11 N12 R19 Y24 N75 G78 E99 H101 R108
• Catalytic site (residue number reindexed from 1): P9 N10 R17 Y22 N73 G76 E97 H99 R106
• Enzyme Commision number: 4.2.1.10: 3-dehydroquinate dehydratase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	9PY	A	R19 Y24 N75 G77 G78 H81 H101 I102 S103 R112	R17 Y22 N73 G75 G76 H79 H99 I100 S101 R110

Gene Ontology

Molecular Function

• GO:0003855 3-dehydroquinate dehydratase activity
• GO:0016829 lyase activity

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009073 aromatic amino acid family biosynthetic process
• GO:0009423 chorismate biosynthetic process
• GO:0019631 quinate catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4cl0, PDBe:4cl0, PDBj:4cl0
• PDBsum: 4cl0
• UniProt: P9WPX7|AROQ_MYCTU 3-dehydroquinate dehydratase (Gene Name=aroQ)