Structure of PDB 4cgv Chain A |
>4cgvA (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] |
HVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASA YFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYER VLELEPNNFEATNELRKISQALASK |
|
PDB | 4cgv Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1. |
Chain | A |
Resolution | 2.54 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
N197 R198 S199 |
N71 R72 S73 |
|
|
|