Structure of PDB 4cd0 Chain A

Receptor sequence

>4cd0A (length=295) Species: 9606 (Homo sapiens)

PNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSPLQVAVK
TLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMA
GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDI
AARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIF
TSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPG
PVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY

3D structure

• PDB: 4cd0 The Design of Potent and Selective Inhibitors to Overcome Clinical Alk Mutations Resistant to Crizotinib.
• Chain: A
• Resolution: 2.23 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1249 A1251 R1253 N1254 D1270 L1291
• Catalytic site (residue number reindexed from 1): D149 A151 R153 N154 D170 L185
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AWJ	A	L1122 V1130 A1148 M1199 G1202 D1203 L1256 G1269 D1270 Y1401	L29 V37 A48 M99 G102 D103 L156 G169 D170 Y295	MOAD: Ki=0.2nM PDBbind-CN: -logKd/Ki=9.70,Ki=0.2nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:4cd0, PDBe:4cd0, PDBj:4cd0
• PDBsum: 4cd0
• PubMed: 24432909
• UniProt: Q9UM73|ALK_HUMAN ALK tyrosine kinase receptor (Gene Name=ALK)