Structure of PDB 4c9k Chain A

Receptor sequence

>4c9kA (length=408) Species: 48935 (Novosphingobium aromaticivorans)

QKHRVAPPPHVPGHLIREIDAYDLDGLEQGFHEAWKRVQQPDTPPLVWTP
FTGGHWIATRGTLIDEIYRSPERFSSRVIWVPREAGEAYDMVPTKLDPPE
HTPYRKAIDKGLNLAEIRKLEDQIRTIAVEIIEGFADRGHCEFGSEFSTV
FPVRVFLALAGLPVEDATKLGLLANEMTRPSGNTPEEQGRSLEAANKGFF
EYVAPIIAARRGGSGTDLITRILNVEIDGKPMPDDRALGLVSLLLLGGLD
TVVNFLGFMMIYLSRHPETVAEMRREPLKLQRGVEELFRRFAVVSDARYV
VSDMEFHGTMLKEGDLILLPTALHGLDDRHHDDPMTVDLSRRDVTHSTFA
QGPHRCAGMHLARLEVTVMLQEWLARIPEFRLKDRAVPIYHSGIVAAVEN
IPLEWEPQ

3D structure

• PDB: 4c9k Crystal Structures and Functional Characterization of Wild-Type Cyp101D1 and its Active Site Mutants.
• Chain: A
• Resolution: 2.18 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R188 G256 D259 T260 V261 C365 A366 G367 E374 V404
• Catalytic site (residue number reindexed from 1): R179 G247 D250 T251 V252 C356 A357 G358 E365 V395

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	P102 T103 H110 R114 F165 L252 G256 T260 D305 R307 T357 F358 A359 H363 C365 A366 G367	P93 T94 H101 R105 F156 L243 G247 T251 D296 R298 T348 F349 A350 H354 C356 A357 G358
BS02	CAH	A	W89 Y98 L252 L255	W80 Y89 L243 L246
BS03	CAM	A	W89 Y98 L252 L255	W80 Y89 L243 L246

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:4c9k, PDBe:4c9k, PDBj:4c9k
• PDBsum: 4c9k
• PubMed: 24261604
• UniProt: Q2GB12