Structure of PDB 4c72 Chain A

Receptor sequence

>4c72A (length=413) Species: 83332 (Mycobacterium tuberculosis H37Rv)

PSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFVTK
WDLAVKIGGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSPEV
DPDRFAVVVGTGLGGAERIVESYDLMNAGGPRKVSPLAVQMIMPNGAAAV
IGLQLGARAGVMTPVSAQSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIE
ALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFGEAGALMLIETEEH
AKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGLSPA
DIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVGAL
ESVLTVLTLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFG
FGGHNVALAFGRY

3D structure

• PDB: 4c72 Structural Basis for the Recognition of Mycolic Acid Precursors by Kasa, a Condensing Enzyme and Drug Target from Mycobacterium Tuberculosis
• Chain: A
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TLG	A	Q171 A279 P280 H311 T313 H345 F402 G403 F404 G406	Q168 A276 P277 H308 T310 H342 F399 G400 F401 G403	MOAD: Ki=8.2uM PDBbind-CN: -logKd/Ki=5.09,Ki=8.2uM
BS02	M7U	A	G115 E120 E199 G200 P201 E203 L205 F239 E241	G112 E117 E196 G197 P198 E200 L202 F236 E238

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 15:03:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4c72', asym_id = 'A', title = 'Structural Basis for the Recognition of Mycolic ... and Drug Target from Mycobacterium Tuberculosis '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4c72', asym_id='A', title='Structural Basis for the Recognition of Mycolic ... and Drug Target from Mycobacterium Tuberculosis ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016746', uniprot = '', pdbid = '4c72', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016746', uniprot='', pdbid='4c72', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>