Structure of PDB 4c70 Chain A

Receptor sequence

>4c70A (length=415) Species: 83332 (Mycobacterium tuberculosis H37Rv)

SQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFV
TKWDLAVKIGGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSP
EVDPDRFAVVVGTGLGGAERIVESYDLMNAGGPRKVSPLAVQMIMPNGAA
AVIGLQLGARAGVMTPVSAQSSGSEAIAHAWRQIVMGDADVAVCGGVEGP
IEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFGEAGALMLIETE
EHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGLS
PADIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVG
ALESVLTVLTLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNS
FGFGGHNVALAFGRY

3D structure

• PDB: 4c70 Structural Basis for the Recognition of Mycolic Acid Precursors by Kasa, a Condensing Enzyme and Drug Target from Mycobacterium Tuberculosis
• Chain: A
• Resolution: 1.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TLJ	A	Q171 F237 V278 A279 P280 H311 T313 H345 F402 G403 F404 G406	Q170 F236 V277 A278 P279 H310 T312 H344 F401 G402 F403 G405	MOAD: Ki=305uM PDBbind-CN: -logKd/Ki=3.52,Ki=305uM
BS02	M7U	A	G115 E120 G200 P201 E203 E241	G114 E119 G199 P200 E202 E240
BS03	M7U	A	I145 M146	I144 M145

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 08:12:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4c70', asym_id = 'A', title = 'Structural Basis for the Recognition of Mycolic ... and Drug Target from Mycobacterium Tuberculosis '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4c70', asym_id='A', title='Structural Basis for the Recognition of Mycolic ... and Drug Target from Mycobacterium Tuberculosis ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016746', uniprot = '', pdbid = '4c70', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016746', uniprot='', pdbid='4c70', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>