Structure of PDB 4c2z Chain A

Receptor sequence

>4c2zA (length=382) Species: 9606 (Homo sapiens)

RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLG
DRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGV
RVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLI
REITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHL
SRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTP
VMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHK
SLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEK
LKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 4c2z Chemical Proteomics Defines the Mammalian N- Myristoylated Proteome in Live Cells Global Profiling of Co- and Post-Translationally N-Myristoylated Proteomes in Human Cells.
• Chain: A
• Resolution: 2.08 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N246 F247 L248 T282 Q496
• Catalytic site (residue number reindexed from 1): N132 F133 L134 T168 Q382
• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	A	Y117 Q118 F119 W120 Y180 V181 I245 L248 C249 V250 R255 S256 R258 V259 A260 T268 V271 F277 A279 Y281 T282 L287 Y479	Y3 Q4 F5 W6 Y66 V67 I131 L134 C135 V136 R141 S142 R144 V145 A146 T154 V157 F163 A165 Y167 T168 L173 Y365
BS02	646	A	V181 D183 F190 N246 G284 Y296 H298 F311 S405 Y420 D471 Q496	V67 D69 F76 N132 G170 Y182 H184 F197 S291 Y306 D357 Q382	MOAD: ic50=17nM BindingDB: Ki=11nM,IC50=4.0nM
BS03	MG	A	L254 R255 S256 K257 V259	L140 R141 S142 K143 V145

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:4c2z, PDBe:4c2z, PDBj:4c2z
• PDBsum: 4c2z
• PubMed: 25255805
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)