Structure of PDB 4c2s Chain A

Receptor sequence

>4c2sA (length=291) Species: 9606 (Homo sapiens)

MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQ
NTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQLAAVPRV
TLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDV
DMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGD
FYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLR
HKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRN

3D structure

• PDB: 4c2s Structural and Biochemical Characterization of the Human Blood Group a and B Galactosyltransferases Posessing the Pro156Leu Mutation
• Chain: A
• Resolution: 2.48 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H233 L266 W300 E303 A343 R352
• Catalytic site (residue number reindexed from 1): H171 L204 W238 E241 A281 R290
• Enzyme Commision number: 2.4.1.37: fucosylgalactoside 3-alpha-galactosyltransferase.
  2.4.1.40: glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DLG	A	H233 G235 F236 T245 W300 E303	H171 G173 F174 T183 W238 E241
BS02	FUC	A	D326 H348	D264 H286
BS03	MN	A	D211 D213	D149 D151
BS04	UDP	A	F121 I123 Y126 V184 R188 D211 V212 D213 K346 R352	F59 I61 Y64 V122 R126 D149 V150 D151 K284 R290

Gene Ontology

Molecular Function

• GO:0016758 hexosyltransferase activity

Biological Process

• GO:0005975 carbohydrate metabolic process

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:4c2s, PDBe:4c2s, PDBj:4c2s
• PDBsum: 4c2s
• UniProt: P16442|BGAT_HUMAN Histo-blood group ABO system transferase (Gene Name=ABO)