Structure of PDB 4c0h Chain A

Receptor sequence

>4c0hA (length=422) Species: 4932 (Saccharomyces cerevisiae)

GDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTF
QNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRM
SNFEGPRVVIVGGSQTRKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFT
VPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINEN
KDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHI
IEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLVDDVYKRS
LQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFP
VTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRV
LLPVPGRLPSKAMILTSYRYLE

3D structure

• PDB: 4c0h Structural basis for ATP loss by Clp1p in a G135R mutant protein.
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	T168 S179 Q191 S192 L193 T194 S195 G196 A197 H201 Q204 M206 K208 V232 R236 L239 Q242 Y332 L341 S342 P343 A345 I388 F390 P404 L406 R422 P426 V427 P428	T150 S161 Q173 S174 L175 T176 S177 G178 A179 H183 Q186 M188 K190 V214 R218 L221 Q224 Y309 L318 S319 P320 A322 I365 F367 P381 L383 R399 P403 V404 P405

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0051731 polynucleotide 5'-hydroxyl-kinase activity

Biological Process

• GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
• GO:0006396 RNA processing
• GO:0006397 mRNA processing
• GO:0031124 mRNA 3'-end processing

Cellular Component

• GO:0005634 nucleus
• GO:0005849 mRNA cleavage factor complex

External links

• PDB: RCSB:4c0h, PDBe:4c0h, PDBj:4c0h
• PDBsum: 4c0h
• PubMed: 24508575
• UniProt: Q08685|CLP1_YEAST mRNA cleavage and polyadenylation factor CLP1 (Gene Name=CLP1)