Structure of PDB 4c07 Chain A

Receptor sequence
>4c07A (length=326) Species: 10090 (Mus musculus) [Search protein sequence]
LYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGI
LSIFCAQAGARRVYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVEL
PERVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAP
ISDQMLEWRLGFWSQVKQHYGVDMSCMESFATRCLMGHSEIVVQDLSGED
VLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAVWFQVT
FPGGKPLVLSTSPLHPATHWKQALLYLNEPVPVEQDTDISGEITLLPSPD
NPRRLRILLRYKVGDHEEKTKDFAME
3D structure
PDB4c07 Functional Insights from High Resolution Structures of Mouse Protein Arginine Methyltransferase 6.
ChainA
Resolution1.499 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D66 E158 E167 H320
Catalytic site (residue number reindexed from 1) D18 E110 E119 H269
Enzyme Commision number 2.1.1.319: type I protein arginine methyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A E158 M160 E110 M112
BS02 CA A Q242 D243 Q194 D195
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008469 histone arginine N-methyltransferase activity
GO:0016274 protein-arginine N-methyltransferase activity
GO:0035241 protein-arginine omega-N monomethyltransferase activity
GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0042393 histone binding
GO:0044020 histone H4R3 methyltransferase activity
GO:0070611 histone H3R2 methyltransferase activity
GO:0070612 histone H2AR3 methyltransferase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0010821 regulation of mitochondrion organization
GO:0018216 peptidyl-arginine methylation
GO:0032259 methylation
GO:0036211 protein modification process
GO:0045892 negative regulation of DNA-templated transcription
GO:0090398 cellular senescence
GO:1901796 regulation of signal transduction by p53 class mediator
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4c07, PDBe:4c07, PDBj:4c07
PDBsum4c07
PubMed26094878
UniProtQ6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 (Gene Name=Prmt6)

[Back to BioLiP]