Structure of PDB 4bxw Chain A

Receptor sequence
>4bxwA (length=286) Species: 8673 (Pseudonaja textilis) [Search protein sequence]
CRVDNGNCWHFCKHIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKIVNGM
DCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVG
EIDKSRIETGPLLSVDKIYVHKKFVPPQKAYKFDLAAYDYDIAIIQMKTP
IQFSENVVPACLPTADFANQVLMKQDFGIVSGFGRIVEKGPKSKTLKVLK
VPYVDRHTCMVSSETPITPNMFCAGYDTLPRDACQGDSGGPHTTVYRDTH
FITGIVSSGEGCARNGKYGNYTKLSKFIPWIKRIMR
3D structure
PDB4bxw Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
ChainA
Resolution2.71 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H211 D265 Q359 G360 D361 S362 G363
Catalytic site (residue number reindexed from 1) H87 D141 Q235 G236 D237 S238 G239
Enzyme Commision number 3.4.21.6: coagulation factor Xa.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A N214 K241 I242 Y243 V244 H245 K246 W404 N90 K117 I118 Y119 V120 H121 K122 W280
BS02 0GJ A H211 Y262 D356 A357 C358 Q359 S362 S381 S382 G383 H87 Y138 D232 A233 C234 Q235 S238 S257 S258 G259
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008236 serine-type peptidase activity
GO:0016504 peptidase activator activity
GO:0090729 toxin activity
Biological Process
GO:0002690 positive regulation of leukocyte chemotaxis
GO:0006508 proteolysis
GO:0007596 blood coagulation
GO:0010952 positive regulation of peptidase activity
GO:0035807 induction of blood coagulation in another organism
GO:0044469 envenomation resulting in positive regulation of blood coagulation in another organism
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4bxw, PDBe:4bxw, PDBj:4bxw
PDBsum4bxw
PubMed23869089
UniProtQ56VR3|FAXC_PSETE Venom prothrombin activator pseutarin-C catalytic subunit

[Back to BioLiP]