Structure of PDB 4bvm Chain A

Receptor sequence

>4bvmA (length=133) Species: 9606 (Homo sapiens)

GMSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDI
ITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWD
GKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

3D structure

• PDB: 4bvm Atomic Resolution View Into the Structure-Function Relationships of the Human Myelin Peripheral Membrane Protein P2
• Chain: A
• Resolution: 0.93 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	VCA	A	P38 T53 A75 D76 R106 R126 Y128	P40 T55 A77 D78 R108 R128 Y130

Gene Ontology

Molecular Function

• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0015485 cholesterol binding

Biological Process

• GO:0015908 fatty acid transport
• GO:0061024 membrane organization

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0043209 myelin sheath
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4bvm, PDBe:4bvm, PDBj:4bvm
• PDBsum: 4bvm
• PubMed: 24419389
• UniProt: P02689|MYP2_HUMAN Myelin P2 protein (Gene Name=PMP2)