Structure of PDB 4bs1 Chain A |
>4bs1A (length=73) Species: 10677 (Muvirus mu) [Search protein sequence] |
ERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKN VIERAVLFSEGKFIDRGELSCLV |
|
PDB | 4bs1 Mub is an Aaa+ ATPase that Forms Helical Filaments to Control Target Selection for DNA Transposition. |
Chain | A |
Resolution | 18.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ADP |
A |
L320 V356 R357 K360 |
L9 V45 R46 K49 |
|
|
|
|