Structure of PDB 4bnc Chain A

Receptor sequence
>4bncA (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPA
MNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFSD
3D structure
PDB4bnc Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
ChainA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R391 R394 Y397 K404 R409 Y410 R58 R61 Y64 K71 R76 Y77
BS02 dna A Q336 W375 K379 M384 K388 R391 S392 Y395 Y396 D428 Q3 W42 K46 M51 K55 R58 S59 Y62 Y63 D95
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4bnc, PDBe:4bnc, PDBj:4bnc
PDBsum4bnc
PubMed25866208
UniProtP50549|ETV1_HUMAN ETS translocation variant 1 (Gene Name=ETV1)

[Back to BioLiP]