Structure of PDB 4b68 Chain A

Receptor sequence

>4b68A (length=454) Species: 746128 (Aspergillus fumigatus)

RLRSTPQDELHDLLCVGFGPASLAIAIALHDALDPRLNKSASNIHAQPKI
CFLERQKQFAWHSGMLVPGSKMQISFIKDLATLRDPRSSFTFLNYLHQKG
RLIHFTNLSTFLPARLEFEDYMRWCAQQFSDVVAYGEEVVEVIPGKSDPS
SSVVDFFTVRSRNVETGEISARRTRKVVIAIGGTAKMPSGLPQDPRIIHS
SKYCTTLPALLKDKSKPYNIAVLGSGQSAAEIFHDLQKRYPNSRTTLIMR
DSAMRPSDDSPFVNEIFNPERVDKFYSQSAAERQRSLLADKATNYSVVRL
ELIEEIYNDMYLQRVKNPDETQWQHRILPERKITRVEHHGPQSRMRIHLK
SSKPVKETLEVDALMVATGYNRNAHERLLSKVQHLRPTGQDQWKPHRDYR
VEMDPSKVSSEAGIWLQGCNERTHGLSDSLLSVLAVRGGEMVQSIFGEQL
ERAA

3D structure

• PDB: 4b68 Structural Insight Into the Mechanism of Oxygen Activation and Substrate Selectivity of Flavin-Dependent N-Hydroxylating Monooxygenases.
• Chain: A
• Resolution: 2.29 Å

Enzymatic activity

• Enzyme Commision number: 1.14.13.196: L-ornithine N(5)-monooxygenase [NAD(P)H].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ARG	A	Q102 I103 K107 N293 F296 T322 N323 S469	Q73 I74 K78 N264 F267 T293 N294 S432
BS02	FAD	A	G48 P49 A50 E83 R84 Q85 W90 H91 M101 Q102 I103 E167 V168 I210 G211 Y407 S466 L467 L468	G19 P20 A21 E54 R55 Q56 W61 H62 M72 Q73 I74 E138 V139 I181 G182 Y370 S429 L430 L431
BS03	NAP	A	K100 Q102 P217 S254 G255 Q256 S257 E260 R279 N323 S325 A404 T405	K71 Q73 P188 S225 G226 Q227 S228 E231 R250 N294 S296 A367 T368

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004497 monooxygenase activity
• GO:0004499 N,N-dimethylaniline monooxygenase activity
• GO:0005506 iron ion binding
• GO:0031172 ornithine N5-monooxygenase activity
• GO:0070401 NADP+ binding

Biological Process

• GO:0006696 ergosterol biosynthetic process
• GO:0006879 intracellular iron ion homeostasis
• GO:0009058 biosynthetic process
• GO:0010106 cellular response to iron ion starvation
• GO:0019290 siderophore biosynthetic process
• GO:0031169 ferrichrome biosynthetic process
• GO:0033214 siderophore-dependent iron import into cell
• GO:0044550 secondary metabolite biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:4b68, PDBe:4b68, PDBj:4b68
• PDBsum: 4b68
• PubMed: 22928747
• UniProt: E9QYP0|SIDA_ASPFU L-ornithine N(5)-monooxygenase (Gene Name=sidA)