Structure of PDB 4b2h Chain A |
>4b2hA (length=62) Species: 478009 (Halobacterium salinarum R1) [Search protein sequence] |
VFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVAIGAVRT YQTEVQVAFELD |
|
PDB | 4b2h The Flavoprotein Dodecin as a Redox Probe for Electron Transfer Through DNA. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
C3F |
A |
V35 W36 |
V34 W35 |
|
|
|
|