Structure of PDB 4awm Chain A

Receptor sequence

>4awmA (length=178) Species: 641501 (Influenza A virus (A/California/04/2009(H1N1)))

AMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYS
DFGALLKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENR
FIEIGVTRREVHIYYLEKANKIEKTHIHIFSFTGEEMATKADYTLDEESR
ARIKTRLFTIRQEMASRSLWDSFRQSER

3D structure

• PDB: 4awm Structural Analysis of Specific Metal Chelating Inhibitor Binding to the Endonuclease Domain of Influenza Ph1N1 (2009) Polymerase.
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H42 D92 E103 I104
BS02	MN	A	E80 D108	E64 D92
BS03	KDH	A	Y24 E26 K34 A37 I38 H41 E80 D108 E119 K134	Y25 E27 K35 A38 I39 H42 E64 D92 E103 K118	PDBbind-CN: -logKd/Ki=5.72,IC50=1.9uM
BS04	KDH	A	D83 I85	D67 I69	PDBbind-CN: -logKd/Ki=5.72,IC50=1.9uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:4awm, PDBe:4awm, PDBj:4awm
• PDBsum: 4awm
• PubMed: 22876177
• UniProt: C3W5S0