Structure of PDB 4avb Chain A

Receptor sequence

>4avbA (length=324) Species: 83332 (Mycobacterium tuberculosis H37Rv)

GARVEDLAGMDVFQGCPAEGLVSLAASVQPLRAAAGQVLLRQGEPAVSFL
LISSGSAEVSHVGDDGVAIIARALPGMIVGEIALLRDSPRSATVTTIEPL
TGWTGGRGAFATMVHIPGVGERLLRTARQRLAAFVSPIPVRLADGTQLML
RPVLPGDRERTVHGHIQFSGETLYRRFMSARVPSPALMHYLSEVDYVDHF
VWVVTDGSDPVADARFVRDETDPTVAEIAFTVADAYQGRGIGSFLIGALS
VAARVDGVERFAARMLSDNVPMRTIMDRYGAVWQREDVGVITTMIDVPGP
GELSLGREMVDQINRVARQVIEAV

3D structure

• PDB: 4avb Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CMP	A	V67 A79 V87 G88 E89 I90 A91 R98 S99 R138 F142	V59 A71 V79 G80 E81 I82 A83 R90 S91 R130 F134
BS02	ACO	A	T180 R183 A237 F238 T239 V240 Q245 G246 G248 G250 S251 R272 V278 P279 M280 T282 I283	T172 R175 A229 F230 T231 V232 Q237 G238 G240 G242 S243 R264 V270 P271 M272 T274 I275

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0016407 acetyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0030552 cAMP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4avb, PDBe:4avb, PDBj:4avb
• PDBsum: 4avb
• PubMed: 22773105
• UniProt: O05581|PAT_MYCTU Acetyltransferase Pat (Gene Name=Rv0998)