Structure of PDB 4auw Chain A

Receptor sequence
>4auwA (length=87) Species: 10090 (Mus musculus) [Search protein sequence]
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQ
QKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKS
3D structure
PDB4auw Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare
ChainA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R249 Q253 R256 S298 R38 Q42 R45 S87
BS02 dna A K240 R243 R244 K247 Y251 C255 K258 R259 K29 R32 R33 K36 Y40 C44 K47 R48
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4auw, PDBe:4auw, PDBj:4auw
PDBsum4auw
PubMed17671361
UniProtP54841|MAFB_MOUSE Transcription factor MafB (Gene Name=Mafb)

[Back to BioLiP]