Structure of PDB 4auv Chain A

Receptor sequence
>4auvA (length=35) Species: 9606 (Homo sapiens) [Search protein sequence]
SEDYERRRSECVSEMLDLEKQFSELKEKLFRERLS
3D structure
PDB4auv Brms151-98 and Brms151-84 are Crystal Oligomeric Coiled Coils with Different Oligomerization States, which Behave as Disordered Protein Fragments in Solution.
ChainA
Resolution1.999 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E68 F71 K75 E19 F22 K26
BS02 peptide A E59 C60 E63 M64 L67 Q70 F71 L74 E10 C11 E14 M15 L18 Q21 F22 L25
BS03 peptide A R57 C60 R8 C11
BS04 peptide A S50 Y53 S1 Y4
External links
PDB RCSB:4auv, PDBe:4auv, PDBj:4auv
PDBsum4auv
PubMed23500495
UniProtQ9HCU9|BRMS1_HUMAN Breast cancer metastasis-suppressor 1 (Gene Name=BRMS1)

[Back to BioLiP]