Structure of PDB 4ar5 Chain A |
>4ar5A (length=54) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] |
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE KLED |
|
PDB | 4ar5 Near-Atomic Resolution Neutron Crystallography on Perdeuterated Pyrococcus Furiosus Rubredoxin: Implication of Hydronium Ions and Protonation Equilibria and Hydronium Ions in Redox Changes |
Chain | A |
Resolution | 1.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
C5 C8 C38 C41 |
C6 C9 C39 C42 |
|
|
|
|