Structure of PDB 4ar3 Chain A

Receptor sequence
>4ar3A (length=54) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE
KLED
3D structure
PDB4ar3 Near-Atomic Resolution Neutron Crystallography on Perdeuterated Pyrococcus Furiosus Rubredoxin: Implication of Hydronium Ions and Protonation State Equilibria in Redox Changes.
ChainA
Resolution1.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE A C5 C8 C38 C41 C6 C9 C39 C42
BS02 D8U A L51 E52 L52 E53
BS03 D3O A A1 K2 L51 A2 K3 L52
BS04 D3O A S24 P25 S25 P26
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Biological Process
GO:0043448 alkane catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ar3, PDBe:4ar3, PDBj:4ar3
PDBsum4ar3
PubMed23225503
UniProtP24297|RUBR_PYRFU Rubredoxin (Gene Name=rub)

[Back to BioLiP]