Structure of PDB 4al0 Chain A

Receptor sequence

>4al0A (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]

VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGP
QYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVF
LVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

3D structure

PDB

4al0 Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.

Chain

Resolution

1.16 Å

3D
structure

Enzymatic activity

Enzyme Commision number

1.11.1.-
2.5.1.18: glutathione transferase.
5.3.99.3: prostaglandin-E synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	R73 N74 E77 H113 Y117 R126 S127 Y130	R67 N68 E71 H107 Y111 R120 S121 Y124

Gene Ontology

	Molecular Function
GO:0004364	glutathione transferase activity
GO:0004602	glutathione peroxidase activity
GO:0004667	prostaglandin-D synthase activity
GO:0005515	protein binding
GO:0016491	oxidoreductase activity
GO:0016740	transferase activity
GO:0016853	isomerase activity
GO:0043295	glutathione binding
GO:0050220	prostaglandin-E synthase activity

	Biological Process
GO:0001516	prostaglandin biosynthetic process
GO:0006693	prostaglandin metabolic process
GO:0007165	signal transduction
GO:0008283	cell population proliferation
GO:0008285	negative regulation of cell population proliferation
GO:0019233	sensory perception of pain
GO:0031620	regulation of fever generation
GO:0032308	positive regulation of prostaglandin secretion
GO:0050727	regulation of inflammatory response
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005641	nuclear envelope lumen
GO:0005737	cytoplasm
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0048471	perinuclear region of cytoplasm

External links

PDB	RCSB:4al0, PDBe:4al0, PDBj:4al0
PDBsum	4al0
PubMed	23431194
UniProt	O14684\|PTGES_HUMAN Prostaglandin E synthase (Gene Name=PTGES)