Structure of PDB 4aiz Chain A |
>4aizA (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
YELMQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQAPVLVIYKDS ERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGTYVVFGG GTKLTVL |
|
PDB | 4aiz Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains. |
Chain | A |
Resolution | 1.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
88Q |
A |
Q37 Y86 |
Q36 Y85 |
|
|
|
|