Structure of PDB 4aao Chain A

Receptor sequence

>4aaoA (length=303) Species: 243231 (Geobacter sulfurreducens PCA)

EDVMKRAQGLFKPIPAKPPVMKDNPASPSRVELGRMLFFDPRLSASHLIS
CNTCHNVGLGGTDILETSGPRNSPTVLNAVYNIAQFWDGRAEDLAAAKGP
VQASVEMNNKPENLVATLKSIPGYPPLFRKAFPGQGDPVTFDNVAKAIEV
FEATLVTPDAPFDKYLKGNRKAISSTAEQGLALFLDKGCAACHSGVNMGG
TGYFPFGVREDYKVTSTAADKYVFRSPSLRNVAITMPYFHSGKVWKLKDA
VKIMGSAQLGISITDADADKIVTFLNTLTGAQPKVMHPVLPPNSDDTPRP
VSN

3D structure

• PDB: 4aao Maca is a Second Cytochrome C Peroxidase of Geobacter Sulfurreducens.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E106
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C73 C76 H77 P103 A108 N111 W116 P130 S134 M137 E182 R268	C51 C54 H55 P74 A79 N82 W87 P100 S104 M107 E152 R225
BS02	HEC	A	W116 C219 C222 H223 F236 R268 S269 P270 L272 F282 H283 M297 L302	W87 C189 C192 H193 F206 R225 S226 P227 L229 F239 H240 M254 L259
BS03	CA	A	N101 T278 P280	N72 T235 P237

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0004601 peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:4aao, PDBe:4aao, PDBj:4aao
• PDBsum: 4aao
• PubMed: 22417533
• UniProt: Q74FY6