Structure of PDB 4aal Chain A

Receptor sequence

>4aalA (length=320) Species: 243231 (Geobacter sulfurreducens PCA)

EDVMKRAQGLFKPIPAKPPVMKDNPASPSRVELGRMLFFDPRLSASHLIS
CNTCHNVGLGGTDILETSIGHGWQKGPRNSPTVLNAVYNIAQFWDGRAED
LAAQAKGPVQASVEMNNKPENLVATLKSIPGYPPLFRKAFPGQGDPVTFD
NVAKAIEVFEATLVTPDAPFDKYLKGNRKAISSTAEQGLALFLDKGCAAC
HSGVNMGGTGYFPFGVREDPGPVDDTGRYKVTSTAADKYVFRSPSLRNVA
ITMPYFHSGKVWKLKDAVKIMGSAQLGISITDADADKIVTFLNTLTGAQP
KVMHPVLPPNSDDTPRPVSN

3D structure

• PDB: 4aal Maca is a Second Cytochrome C Peroxidase of Geobacter Sulfurreducens.
• Chain: A
• Resolution: 1.84 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E114
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C73 C76 H77 S90 G92 H93 W95 Q96 R100 S102 P103 N111 Q114 F115 W116 Q132 R268	C51 C54 H55 S68 G70 H71 W73 Q74 R78 S80 P81 N89 Q92 F93 W94 Q110 R242
BS02	HEC	A	F214 C219 C222 H223 F234 G237 R268 S269 P270 L272 Y281 F282 H283 M297 L302	F192 C197 C200 H201 F212 G215 R242 S243 P244 L246 Y255 F256 H257 M271 L276
BS03	CA	A	N101 T278 P280	N79 T252 P254

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0004601 peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:4aal, PDBe:4aal, PDBj:4aal
• PDBsum: 4aal
• PubMed: 22417533
• UniProt: Q74FY6