Structure of PDB 4aab Chain A

Receptor sequence

>4aabA (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD

3D structure

PDB

4aab Non-Specific Protein-DNA Interactions Control I-Crei Target Binding and Cleavage.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G19 D20
Catalytic site (residue number reindexed from 1)	G18 D19
Enzyme Commision number	3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	D20 T46 Q47 K48 R51	D19 T45 Q46 K47 R50
BS02	dna	A	G19 D20 G21 S22 Q26 K28 N30 Q44 R70 N136 D137 S138 T140 R141 K142	G18 D19 G20 S21 Q25 K27 N29 Q43 R69 N135 D136 S137 T139 R140 K141
BS03	dna	A	S32 Y33 K34 Q38 Y66 R68 R70 I81 K116 K139 T140	S31 Y32 K33 Q37 Y65 R67 R69 I80 K115 K138 T139

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4aab, PDBe:4aab, PDBj:4aab
PDBsum	4aab
PubMed	22495931
UniProt	P05725\|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]