Structure of PDB 4a99 Chain A

Receptor sequence

>4a99A (length=368) Species: 818 (Bacteroides thetaiotaomicron)

NLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREARIFGGTLD
LHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVKPENRFD
NPEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETA
DLVILANGGMSKVRKFVTDTEVEETGTFNIQADIHQPEINCPGFFQLCNG
NRLMASHQGNLLFANPNNNGALHFGISFKTPDEWTQVDFQNRNSVVDFLL
KEFSDWDERYKELIHTTLSFVGLATRIFPLEKPWKSKRPLPITMIGDAAH
LMPPFAGQGVNSGLVDALILSDNLADGKFNSIEEAVKNYEQQMFIYGKEA
QEESTQNEIEMFKPDFTF

3D structure

• PDB: 4a99 Putative Dioxygen-Binding Sites and Recognition of Tigecycline and Minocycline in the Tetracycline-Degrading Monooxygenase Tetx
• Chain: A
• Resolution: 2.18 Å

Enzymatic activity

• Enzyme Commision number: 1.14.13.231: tetracycline 11a-monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G23 G25 P26 V27 E46 R47 L60 R117 L139 N168 G169 G310 D311 P318 G323 V324	G12 G14 P15 V16 E35 R36 L49 R106 L128 N157 G158 G296 D297 P304 G309 V310
BS02	MIY	A	F224 N226 H234 P318 F319 A320 G321	F213 N215 H223 P304 F305 A306 G307
BS03	MIY	A	Q78 Y81 F110	Q67 Y70 F99
BS04	MIY	A	P106 E107 R109 F110	P95 E96 R98 F99

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004497 monooxygenase activity
• GO:0071949 FAD binding

Biological Process

• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4a99, PDBe:4a99, PDBj:4a99
• PDBsum: 4a99
• PubMed: 23999299
• UniProt: Q93L51|TETX_BACT4 Flavin-dependent monooxygenase (Gene Name=tetX2)