Structure of PDB 4a71 Chain A

Receptor sequence

>4a71A (length=293) Species: 4932 (Saccharomyces cerevisiae)

TPLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNAIGYGPVLVRLAW
HTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPW
ISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDA
DYVRTFFQRLNMNDREVVALMGAHALGKTHLKRSGYEGPWGAANNVFTNE
FYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEY
ANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL

3D structure

• PDB: 4a71 Crystal Structure of Guaiacol and Phenol Bound to a Heme Peroxidase.
• Chain: A
• Resolution: 1.61 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R48 H52 H175 W191 D235
• Catalytic site (residue number reindexed from 1): R47 H51 H174 W190 D234
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	P44 R48 W51 P145 D146 A147 L171 M172 A174 H175 G178 K179 T180 H181 R184 S185 W191 L232	P43 R47 W50 P144 D145 A146 L170 M171 A173 H174 G177 K178 T179 H180 R183 S184 W190 L231
BS02	IPH	A	F89 E93 H96 S104 L107 F108	F88 E92 H95 S103 L106 F107
BS03	IPH	A	L30 I40 G41 G43 M119	L29 I39 G40 G42 M118

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0020037 heme binding

Biological Process

• GO:0006979 response to oxidative stress
• GO:0034599 cellular response to oxidative stress

External links

• PDB: RCSB:4a71, PDBe:4a71, PDBj:4a71
• PDBsum: 4a71
• PubMed: 22093282
• UniProt: P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial (Gene Name=CCP1)