Structure of PDB 4a6w Chain A

Receptor sequence
>4a6wA (length=262) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence]
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVN
EQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVI
KDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGA
AIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTF
TIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLR
KDDTIPAIISHD
3D structure
PDB4a6w Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
ChainA
Resolution1.46 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN A D108 H171 E204 E235 D107 H170 E203 E234
BS02 5C1 A C59 Y62 Y65 C70 H79 D97 D108 H171 F177 H178 W221 E235 C58 Y61 Y64 C69 H78 D96 D107 H170 F176 H177 W220 E234 MOAD: ic50=1.9uM
PDBbind-CN: -logKd/Ki=5.72,IC50=1.9uM
BS03 MN A D97 D108 E235 D96 D107 E234
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 02:05:19 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4a6w', asym_id = 'A', title = 'Hydroxamic Acids as Potent Inhibitors of Fe(II) ...res of Oxazole Hydroxamate-Ecmetap-Mn Complexes. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4a6w', asym_id='A', title='Hydroxamic Acids as Potent Inhibitors of Fe(II) ...res of Oxazole Hydroxamate-Ecmetap-Mn Complexes. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006508,0070006', uniprot = '', pdbid = '4a6w', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006508,0070006', uniprot='', pdbid='4a6w', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>